Gene ML2141
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE CONSERVED TRANSMEMBRANE PROTEIN |
| Comments | ML2141, len: 91 aa. Possible conserved transmembrane protein. Similar to Mycobacterium tuberculosis hypothetical 9.5 kda protein Rv0879c SW:Y879_MYCTU (Q10541) fasta scores: E(): 6.6e-25, 76.9% in 91 aa. Contains membrane spanning domains. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2542627 | 2542902 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2141|ML2141
MLVEPDRSREPPPLPSMLLEVWPVIMVGALAWLIAVVAAFVVSSLQSWRPVALAGLVVGLFGTGIFVWQLAAARRGARGAQGGLETYLDPR
Bibliography
No article yet recorded