Gene ML2151 (rpfA)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2151, len: 174 aa. Conserved hypothetical protein. Similar to C-terminus of Mycobacterium tuberculosis rpfA, resuscitation-promoting factor TR:O53879 (EMBL:AL022004) fasta scores: E(): 4.8e-29, 63.0% in 200 aa. Also similar to ML0240 and ML2030 from M. leprae. |
| Functional category | Conserved hypotheticals, Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2554752 | 2555276 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2151|ML2151
MSESYRKLTTSSIIVAKITFTGAMLDGSIALAGQASPATDSEWDQVARCESGGNWSINTGNGYLGGLQFSQGTWASHGGGEYAPSAQLATREQQIAVAERVLATQGSGAWPACGHGLSGPSLQEVLPAGMGAPWINGAPAPLAPPPPAEPAPPQPPADNFPPTPGDVPSPLARP
Bibliography
No article yet recorded