Gene ML2258c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2258c, len: 100 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0543c OR MTCY25D10.22C TR:O06409 (EMBL:Z95558) fasta scores: E(): 1.4e-27, 73.5% identity in 98 aa, and to Mycobacterium tuberculosis hypothetical 13.4 kda protein Rv3046c OR MTV012.61C TR:O53292 (EMBL:AL021287) fasta scores: E(): 6.8e-07, 35.9% identity in 103 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2682535 | 2682837 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2258c|ML2258c
VNRFLTSIVSWLRAGYPEGIPATDTFAVLALLARRLTNDEVKLVARELIRRGEFDKIDIGVMISHLTDELPSPQDIERVRTRLNAKGWLLDNARDNGEPT
Bibliography
No article yet recorded