Gene ML2261c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2261c, len: 138 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0546c OR MTCY25D10.25C TR:O06412 (EMBL:Z95558) fasta scores: E(): 0, 84.7% identity in 131 aa. Also some similarity to Haemophilus influenzae lactoylglutathione lyase GLOA OR HI0323 SW:LGUL_HAEIN (P44638) fasta scores: E(): 0.084, 29.1% identity in 127 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2684496 | 2684912 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2261c|ML2261c
MEILASRMLLRPTDYQRSLSFYRDQIGLAIAREYGTGTVFFAGQSLLELAGYVIQGAPDHSRGAFPGALWLQVRDIAVTQADLEGRGVSITREPRREPWGLHEMHVTDPDEITLIFVEVPANHPLRRDTRSERPRTPD
Bibliography
No article yet recorded