Gene ML2296
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CONSERVED TRANSMEMBRANE PROTEIN |
| Comments | ML2296, len: 181 aa. Probable conserved transmembrane protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv3669 or MTV025.017 TR:O69637 (EMBL:AL022121) (172 aa) fasta scores: E(): 0, 77.9% identity in 181 aa. Similar to Streptomyces coelicolor putative integral membrane transport protein SCH5.28 TR:Q9X930 (EMBL:AL035636) (162 aa) fasta scores: E(): 3.3e-10, 37.3% identity in 153 aa, and to putative integral membrane protein SCI7.29C TR:Q9X9W1 (EMBL:AL096743) (165 aa) fasta scores: E(): 1.1e-05, 32.1% identity in 134 aa. Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2721471 | 2722016 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2296|ML2296
MSKGDRKNGVPSTLTTIPLVDPHAEPTEPSIGDLIKDATTQVSTLVRAEVELARAEIIRDVKKGLTGSVFFIAALVVLFYSTFFFFLFLAELLDTWLWRWVALLIVFAIMVMVTAALALLGYVKIRRIRGPHQTIESVKETRTALTPGHDKAQARPRKLTGSGTNPENNPDRRTPADPSGW
Bibliography
No article yet recorded