Gene ML2332c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2332c, len: 145 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical 15.7 kDa protein Rv3718c TR:O69685 (EMBL:AL022121) (147 aa) fasta scores: E(): 0, 81.9% identity in 144 aa and Streptomyces coelicolor conserved hypothetical protein TR:Q9ZBJ2 (EMBL:AL035161) (147 aa) fasta scores: E(): 1.4e-22, 47.6% identity in 147 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2762496 | 2762933 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2332c|ML2332c
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGPGTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPGSSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
Bibliography
No article yet recorded