Gene ML2380c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible secreted protein |
| Comments | ML2380c, len: 153 aa. Possible secreted protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0455c TR:O53740 (EMBL:AL021932) (148 aa) fasta scores: E(): 0, 66.4% id in 152 aa. Contains a possible N-terminal signal sequence. |
| Functional category | Cell wall and cell processes, Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2850490 | 2850951 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2380c|ML2380c
MSRLSTSLCKGAVFLVFGIIPVAFPTTAVADGSTEDFPIPRRQIATTCDAEQYLAAVRDTSPIYYQRYMIDMHNKPTDIQQAAVNRIHWFYSLSPTDRRQYSEDTATNVYYEQMATHWGNWAKIFFNNKGVVAKATEVCNQYQAGDMSVWNWP
Bibliography
No article yet recorded