Gene ML2390c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved membrane protein |
| Comments | ML2390c, len: 101 aa. Conserved membrane protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv1083 TR:O53431 (EMBL:AL021897) (88 aa) fasta scores: E(): 4.9e-15, 57.4% identity in 101 aa. Contains a possible membrane spanning domain. |
| Functional category | Cell wall and cell processes, Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2861307 | 2861612 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2390c|ML2390c
VSHIFLTLIADGELQYHGPDFGKASPMGLLVIVLLLVATLLLLWSMNRQLKKIPASFDSEHPELDQAADEGTELGGYLDEEPSDTDRNGPSLPPEPGADSG
Bibliography
No article yet recorded