Gene ML2391c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Mycothiol conjugate amidase Mca (Mycothiol S-conjugate amidase) |
| Comments | ML2391c, len: 290 aa. Probable mca, mycothiol conjugate amidase. Similar to Mycobacterium tuberculosis mca, mycothiol conjugate amidase Rv1082 TR:O53430 (EMBL:AL021897) (288 aa) fasta scores: E(): 0, 86.4% identity in 287 aa. Also weakly similar to Streptomyces lincolnensis lmbE TR:Q54358 (EMBL:X79146) (270 aa) fasta scores: E(): 8.9e-13, 33.0% identity in 282 aa. Also similar to ML1495 from M. leprae. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2861609 | 2862481 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2391c|mca
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLPDDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSVDAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGPFDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFFAAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
Bibliography
No article yet recorded