Gene ML2395c (Ag36)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable Proline-rich antigen homolog Pra |
Comments | ML2395c, len: 249 aa. Probable pra, Proline-rich antigen homolog. Previously characterised Mycobacterium leprae proline-rich antigen Ag36 SW:PRA_MYCLE (P41484) (249 aa) fasta scores: E(): 0, 99.2% identity in 249 aa. Note the N-terminus of this protein is extremely rich in the amino acid Pro and contains a 3xGGSYPPPPP repeats. Contains possible membrane spanning hydrophobic domains. Previously known as Ag36. |
Functional category | Cell wall and cell processes, Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2865047 | 2865796 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2395c|pra MTDQPPPSGSNPTPAPPPPGSSGGYEPSFAPSELGSAYPPPTAPPVGGSYPPPPPPGGSYPPPPPPGGSYPPPPPSTGAYAPPPPGPAIRSLPKEAYTFWVTRVLAYVIDNIPATVLLGIGMLIQTLTKQEACVTDITQYNVNQYCATQPTGIGMLAFWFAWLMATAYLVWNYGYRQGATGSSIGKTVMKFKVISEATGQPIGFGMSVVRQLAHFVDAVICCIGFLFPLWDSKRQTLADKIMTTVCLPI
Bibliography
No article yet recorded