Gene ML2413c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible phosphoglycerate mutase |
| Comments | ML2413c, len: 202 aa. Possible phosphoglycerate mutase (EC 5.4.2.1). Similar to Mycobacterium tuberculosis conserved hypothetical protein Rv0525 TR:O06391 (EMBL:Z95558) (202 aa) fasta scores: E(): 0, 82.5% identity in 200 aa, and to Escherichia coli probable phosphoglycerate mutase SW:PMG2_ECOLI (P36942) (215 aa) fasta scores: E(): 0.002, 26.1% identity in 184 aa. Contains Pfam match to entry PF00300 PGAM, Phosphoglycerate mutase family. |
| Functional category | Intermediary metabolism and respiration, Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2884103 | 2884711 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2413c|ML2413c
MAEHNRVHVVRHGEVDNPTGILYGRLAGFGLSETGRAQVAAVADALADRDVVAVIASPLQRAQETAAPIAEKHNLPVDTDPDLIESVSFFEGRRVGLGGSTWRDPRLWWQLRNPFTPSWGESYIEIAARMTTAMDKARTRGAGHEVVCVSHQLPVWTLRLHLTGKRLWHDPRRRDCALASVTTFVYDDDRLVEVEYSQPAGT
Bibliography
No article yet recorded