Gene ML2425
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2425, len: 166 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0504c SW:Y504_MYCTU (Q11168) (166 aa) fasta scores: E(): 0, 83.1% identity in 166 aa. Also similar to ML1908 and ML1910 from M. leprae. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2901013 | 2901513 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2425|ML2425
MTVPLEAEGLIGKHYRQLDHFQVGREKIREFAIAVKDDHPTHYNETAAFEAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINVARVFHRDQKFRFYRTILAQDKLYFDTYLDSVIESHGTVIAEVRSEVTDTEGKAVVTSIVTMLGELARQDATAEETVAAIASI
Bibliography
No article yet recorded