Gene ML2450
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible secreted protein |
| Comments | ML2450, len: 245 aa. Possible secreted protein. Similar to the C-terminal region of Mycobacterium tuberculosis hypothetical protein Rv0479c SW:Y479_MYCTU (Q11145) (348 aa), fasta scores: E(): 0, 70.0% identity in 243 aa. Contains a possible N-terminal signal sequence. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2925770 | 2926507 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2450|ML2450
LLRDPLAIVLILIIVVALVISGLIGAELFARHTANSKVARVVTCEIKDQATAKFGVTPLLLWQFATQHFTNISVETAGNQIRDAKGMKIAIDIQNVQIRDTPTSRGTIGVLDAIITWSSDGIRQSVQNSIPVLGGVVTTSVTTHPTNGTIELKGMLNDIVAKPVVSNGGLQLQIVSFNTLGFSLPKETVQFTLDDFTTNLTKNYPLGIHADNVEVTSTGVTSHFSARNTNIPNSTGGQDPCFANL
Bibliography
No article yet recorded