Gene ML2452c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hypothetical protein |
| Comments | ML2452c, len: 123 aa. Conserved hypothetical protein. Similar in part to Mycobacterium tuberculosis hypothetical protein Rv0477 SW:Y477_MYCTU (Q11144) fasta scores: E(): 1.8e-23, 57.3% identity in 110 aa. |
| Functional category | Conserved hypotheticals, Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2927244 | 2927615 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2452c|ML2452c
MSSPLSPLYVLPFVDHTKWTRWRSLISLQAYSNLFGRTSAMQPDVAAGDEAWGDVLTLSPDADTADMHAQFICHGQFAEFVQPSNTSSNLEPWRPVVDDSEIFAAGCHPGISEGIQQADEGPR
Bibliography
No article yet recorded