Gene ML2474
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | possible cytidine/deoxycytidylate deaminase |
Comments | ML2474, len: 171 aa. Possible cytidine/deoxycytidylate deaminase (EC 3.5.4.-). Similar to several including: Mycobacterium tuberculosis probable cytidine/deoxycytidylate deaminase Rv3752c TR:O69719 (EMBL:AL022121) fasta scores: E(): 0, 87.4% identity in 151 aa, and to Neisseria meningitidis putative cytosine deaminase TR:CAB84390 (EMBL:AL162755) fasta scores: E(): 2e-19, 42.9% identity in 147 aa. Contains Pfam match to entry PF00383 dCMP_cyt_deam, Cytidine and deoxycytidylate deaminase zinc-binding region. Contains PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2948774 | 2949289 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2474|ML2474 MPSAAGRRHQTRSVTTDEDLIRAALTVATTAGSRDVPIGAVVLGADGNELARAVNAREAIGDPTAHAEILAMRAAAGTLGNGWRLEGTTLAVTVEPCTMCAGALVLARIERLVFGAWQPKTGAVGSLWDVVRDHRLNHRPAVRGGVLAQECTAPLEAFFAHQRLSKGPPVR
Bibliography
No article yet recorded