Gene ML2534c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PE-family protein |
| Comments | ML2534c, len: 102 aa. Member of the PE protein family. Similar to Mycobacterium tuberculosis PE-family protein Rv0285 PE5 MTV035.13 TR:O53690 (EMBL:AL021930) fasta scores: E(): 2.1e-23, 73.0% identity in 100 aa. |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3016111 | 3016419 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2534c|PE10
MTLRVVPEKLAATSEAMKALTARLEAAHAAAFPCLVAVVPPAADPVSLQTAAGFSARGQEHALVAAQGVEELGRAGIGVGQSSTHYAISDALAASTYGIVES
Bibliography
No article yet recorded