Gene ML2609
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2609, len: 135 aa. Conserved hypothetical protein. Similar in parts to several proteins of undefined function e.g. Mycobacterium tuberculosis hypothetical protein Rv0190 TR:O07434 (EMBL:Z97050) fasta scores: E(): 6.6e-27, 82.6% identity in 92 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3114791 | 3115198 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2609|ML2609
MLDHRRSRRSWQPRSIVSQMLSAVLGWLGEGLNEDTVREDDNRYGYSQQKGNYAKRLRRIEGQVRGIARMIDEDKYCIDILTQISAVSNALRSVALNLLDEHLEYCVSRAVAEGGSEAEDKFAEASAAIARLVRS
Bibliography
No article yet recorded