Gene ML2618c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable integral membrane protein |
| Comments | ML2618c, len: 352 aa. Probable integral membrane protein. Similar to several proteins of undefined function including: Mycobacterium tuberculosis Rv0204c TR:O53655 (EMBL:AL021928) fasta scores: E(): 0, 82.6% identity in 374 aa, and to Methanobacterium thermoautotrophicum SW:YC61_METTH (O27329) fasta scores: E(): 0.00014, 24.7% identity in 324 aa. Contains a possible N-terminal signal sequence and several other possible membrane spanning hydrophobic domains. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3126443 | 3127501 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2618c|ML2618c
VSPAGGGEAPPGKYWWVRWVVLSLVAIVLVVELALGWDQLAKAWTSVYEANWWWLLAAVLAAAAAVHSFAQIQRTLLKSAGVNVKQLRSEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTVVASWQLVMSGVLQAVGLALLALGGAFFLGAKNNPFSLLFALAGFVTLLLLAQAVASRPELIEGIGRRVLSWVNSVRGKSADTGLDKWRQTLTQLESVSLGRRDLAMAFSWSLFNWIADVACLGFAAYAAGDHASVAGLTVAYAAARAVGTIPLMPGGLLVVEAVLVPGLVSSGMSLPSAISAMLIYRLISWLLIAAIGWVVFFFMFRTENVTDPDDLGCNPDQPLD
Bibliography
No article yet recorded