Gene ML2622c 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable tRNA (guanine-N(7)-)-methyltransferase (tRNA(m7G46)-methyltransferase ) | 
| Comments | ML2622c, len: 230 aa. Probable tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33). Similar to several e.g. Mycobacterium tuberculosis Rv0208c TR:P96390 (EMBL:Z92669) fasta scores: E(): 0, 64.2% identity in 246 aa, and to Neisseria meningitidis TR:AAF41703 (EMBL:AE002481) fasta scores: E(): 6e-25, 34.9% identity in 232 aa. Belongs to the methyltransferase superfamily. TrmB family. | 
| Functional category | Intermediary metabolism and respiration | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3132585 | 3133277 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML2622c|ML2622c
VARHLPATAFRKRRSALSHAQRQTWERLWPEIGISAVSQTRSAERLDTGAWFGRSTLVVLEVGCGSGTATLAMAQHEPDIDVIAVEVYRRGLAQLLCAIDRDQVHNIRMIHGNALYVLQYLIAPRSLTGVRVFFPDPWPKVRHHKRRFLQPATVELIADRLLPGGVLHTATDHPDYAKQIAKFGDGEPLLSRADGRTQLPISTVRPTTKYETKAQHAGNVVTELIWKKRS
      
    Bibliography
    No article yet recorded