Gene ML2622c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable tRNA (guanine-N(7)-)-methyltransferase (tRNA(m7G46)-methyltransferase ) |
| Comments | ML2622c, len: 230 aa. Probable tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33). Similar to several e.g. Mycobacterium tuberculosis Rv0208c TR:P96390 (EMBL:Z92669) fasta scores: E(): 0, 64.2% identity in 246 aa, and to Neisseria meningitidis TR:AAF41703 (EMBL:AE002481) fasta scores: E(): 6e-25, 34.9% identity in 232 aa. Belongs to the methyltransferase superfamily. TrmB family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3132585 | 3133277 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2622c|ML2622c
VARHLPATAFRKRRSALSHAQRQTWERLWPEIGISAVSQTRSAERLDTGAWFGRSTLVVLEVGCGSGTATLAMAQHEPDIDVIAVEVYRRGLAQLLCAIDRDQVHNIRMIHGNALYVLQYLIAPRSLTGVRVFFPDPWPKVRHHKRRFLQPATVELIADRLLPGGVLHTATDHPDYAKQIAKFGDGEPLLSRADGRTQLPISTVRPTTKYETKAQHAGNVVTELIWKKRS
Bibliography
No article yet recorded