Gene MMAR_0742
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in base excision repair. apurinic-apyrimidinic endonuclease. supposed to remove the damaged DNA at cytosines and guanines by cleaving at the 3' side of the ap site by a beta-elimination reaction. possibly exhibites 3'-5'-exonuclease, 3'-phosphomonoesterase, 3'-repair diesterase and ribonuclease H activities [catalytic activity: degradation of double-stranded DNA. it acts progressively in a 3'- to 5'-direction, releasing 5'-phosphomononucleotides]. |
| Product | exodeoxyribonuclease III protein XthA |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 895072 | 895902 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_0742|xthA
MPDGTLRLATWNVNSIRTRLPRVLDWLERADVDVLAIQETKCSDTQFPALPLFELGYEVAHVGFNQWNGVAIASRVGIDDVQIGFDGQPAWSGKPEVAAAAEARAVGATCGGVRVWSLYVPNGRALEDPHYTYKLDWLAALRDTAQCWLKNDPGAPIALAGDFNIAPTDEDVWSTEFFTGATHVSEPERKAFNAIVDAQFTDLVRPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAGRVVDAQIVRDERKGKAPSDHAPVFVDLRPGPAA
Bibliography
No article yet recorded