Gene MMAR_0800
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | required for extrapulmonary dissemination. mediates adherence to epithelial cells by binding to sulfated glycoconjugates present at the surface of these cells; binds heparin, dextran sulfate, fucoidan and chondroitin sulfate. promotes hemagglutination of erythrocytes of certain host species. induces mycobacterial aggregation. |
| Product | iron-regulated heparin binding hemagglutinin HbhA |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 958557 | 959162 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_0800|hbhA
MAENTNIEDLRAPLLAALGAADLALATVNDLIANLRDRAEETRTDTRSRVEESRARLTKLQEDLPEQFTELRERFTSDELRKAAEGYLEAATGRYNDLVQRGEAALERLRSQPAFEDASARAEGYVDQAVELTQEALGTVATQTRAVGERAAKLVGIELPKKEELEAPAKKAPAKKAPAAKKAPAKKAPAKKAPAKKVTQK
Bibliography
No article yet recorded