Gene MMAR_0831
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | essential for the cyclopropanation function. transfers a methylene group from S-adenosyl-L-methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge. mycolic acids, which represent the major constituent of mycobacterial cell wall complex, act as substrates [catalytic activity: S-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid]. |
| Product | cyclopropane-fatty-acyl-phospholipid synthase 2 CmaA2 |
| Comments | - |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 992326 | 993237 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_0831|cmaA2
MGKRGDQPSLPDQLSPPVEAVQSHYDRSNEFFKLFLDPSMTYSCAYFERPDMTLEQAQYAKRKLSLDKLNLEPGMTLLDIGCGWGSTMRHAIEEYDVNVIGLTLSENQLVHDERKFADMDSPRHKEVRLQGWEQFDEPVDRIVSLGAFEHFADGAGDASWERYDRFFKMCYNVLPDDGRMLLHTIIVPDAKEAKELGLTAPMSLMRFIKFILTEIFPGGRLPQIPQIDEYSSRAGFKVERYHRIGSNYVPTLNSWAQALQANQEKAIELQGQEVYDIYMHYLTGCSDLFRDHYTDVCQFTMVK
Bibliography
No article yet recorded
