Gene MMAR_0979
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in mycolic acids modification. catalyzes unusual S-adenosyl-methionine-dependent transformation of a cis-olefin mycolic acid into a secondary alcohol. catalyzes introduction of a hydroxyl group at the distal position on mycolic acid chains to produce the hydroxyl mycolate. mycolic acids represent a major constituent of the mycobacterial cell wall complex. methyl transfer results in formation of a secondary hydroxy group with an adjacent methyl branch; olefinic mycolic acid methyl transferase. |
| Product | methoxy mycolic acid synthase 5 MmaA5_1 |
| Comments | - |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1190091 | 1190957 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_0979|mmaA5_1
MAKELKPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLEEAQIAKIDLALGKLGLEPGMTLLDVGCGWGATMRRAIEKYDVNVVGLTLSKNQAAHVQKSFDQLDTARTRRVLLEGWEQFDEPVDRIVSIGAFEHFGHDRYDDFFTLAHNILPSDGVMLLHTITGLTFQQATDRGMPLTFEIARFIKFIVTEIFPGGRLPSIEKVADHSSKAGFTLTRRQSLQPHYARTLDLWAQALQARRDEAIEVQSEEVYERYMKYLTGCADGFRVGYIDVNQFTLEKS
Bibliography
No article yet recorded