Gene MMAR_0980
in Mycobacterium marinum M
General annotation
Type | CDS |
Function | involved in mycolic acids modification. catalyzes unusual S-adenosyl-methionine-dependent transformation of a cis-olefin mycolic acid into a secondary alcohol. catalyzes introduction of a hydroxyl group at the distal position on mycolic acid chains to produce the hydroxyl mycolate. mycolic acids represent a major constituent of the mycobacterial cell wall complex. methyl transfer results in formation of a secondary hydroxy group with an adjacent methyl branch; olefinic mycolic acid methyl transferase. |
Product | methoxy mycolic acid synthase 1 Mma1 |
Comments | - |
Functional category | Lipid metabolism |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1191104 | 1191964 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_0980|mmaA1 MAELKPYFEDSQATYDISDEFFGLFLDPTWVYTCAYFERDDMTLEEAQLAKLDLALDKLHLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCQRSQDRLAALGTKRRAEARLQGWEEFDEQVDRIVSFEAFDAFRKERYGAFFQRSYDILPAGGSLLLHSLFTYDRRWLHEQGIALTMSDLRFLKFLRESIFPGGEVPSESDIVDNAQAAGFAVEQIQLMQQHYAHTLDIWAANLAAARDRAIAVQSEQVYDNFMHYLTGCAERFRRGLVNVGQFTLTK
Bibliography
No article yet recorded