Gene MMAR_1075
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulator |
| Comments | - |
| Functional category | Regulatory proteins |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1297707 | 1298207 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1075|MMAR_1075
VAPDNKRDPIAAARANWEAGGWGDVAQGMVAVTSVMRAHQILLARVEAALRPYDLSFSRYELLRLLAFSRTGALPITKASDRLQVHVTSVTHAIRRLEADGLVRRVPHPTDGRTTLVQITDLGRSTVEDATVTLNEHVFANIGMSTGESEALVSSIETLRRSAGDF
Bibliography
No article yet recorded