Gene MMAR_1257
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | BirA acts both as a biotin-operon repressor and as the enzyme that synthesizes the corepressor, acetyl-CoA:carbon-dioxide ligase. this protein also activates biotin to form biotinyl-5'-adenylate and transfers the biotin moiety to biotin-accepting proteins [catalytic activity: ATP + biotin + apo-[acetyl-CoA:carbon-dioxide ligase (ADP forming)] = AMP + pyrophosphate + [acetyl-CoA:carbon-dioxide ligase (ADP forming)]]. |
| Product | bifunctional protein BirA |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1537278 | 1538108 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1257|birA
VTDRDQLRLPLDASKLRSEAIDSGWRQLDVVDETGSTNADLLARAAAGADIEGAVLIAEHQTAGRGRLGRGWSATARAQITMSVGVRVDGVPTATWGWLSLATGLAVVDTVTPLLDGTAAQAGLKWPNDVLAGPPGSLGKLAGILAEVAMPYAVIGIGLNVTQAPDEIAGPAATSLLDLGVPAPDRNELAARLLRELAARIDEFRRAHARLSADYRARSLTIGSRVRAQLPGGREIVGIARDIDEQGRLRLQTTPDEAGKSGETVVVAAGDVVHLR
Bibliography
No article yet recorded