Gene MMAR_1260
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in purine biosynthesis (sixth step). possesses an ATPase activity that is dependent on the presence of air (aminoimidazole ribonucleotide). the association of PurK and PurE produces an enzyme complex capable of converting air to cair efficiently under physiological condition [catalytic activity: 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate = 1-(5-phosphoribosyl)-5-aminoimidazole + CO(2)]. |
| Product | phosphoribosylaminoimidazole carboxylase ATPase subunit PurK (air carboxylase) (AirC) |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1539427 | 1540641 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1260|purK
MMAVPSSRTPQVAMVGGGQLARMTHQAAIALGQNLRVLVNSADDPAAQVTPNVVIGSHTDLDDLRRIAAGADVVTFDHEHVPAELLDKLVAEGVVLAPPPQALVHAQDKLVMRRRLQALDVPVPRYLGIHQLEELGELDAFARELDAPLVVKAVRGGYDGRGVQMARDLADARDIASGYLAGGVPVLVEERVQLRRELSALVARSPFGQGAAWPVVETVQQDGICVAVIAPAPALSAQAGADAQQLALRLAAELGVVGVLAVELFETTDGALVVNELAMRPHNSGHWTMDGSRTSQFEQHLRAVLDYPLGDTEAIAPVTVMTNVLGAAAQPAMSLDERLHHLFARMPDARVHLYGKDERPGRKVGHINFLGFDPAAVAGLRERAELAAHWLSHGQWTDGWDPHG
Bibliography
No article yet recorded