Gene MMAR_1783
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in base excision repair (repair of oxidized purines). this enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents [catalytic activity hydrolysis of DNA containing ring-opened N7-methylguanine residues, releasing 2,6-diamino-4-hydroxy-5-(N-methyl)formamidopyrimide]. |
| Product | formamidopyrimidine-DNA glycosylase Fpg |
| Comments | - |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2175510 | 2176388 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1783|fpg
MPELPEVEVVRRGLQDHVVGKTMTAVRVHHPRAVRRHEAGPADLTARLLGARISGTDRRGKYLWLTLDAGAPTTGRDDPDTALVVHLGMSGQMLLGGVPRAEHVRISAVLDDGTVLSFADQRTFGGWQLADLVSVDGSVVPAPVAHLARDPLDPLFDVDSVIKVLRGKHSEIKRQLLDQQVVSGIGNIYADEALWRAKVHGARVAATLTRRQLGAVLDAAADVMREALAKGGTSFDSLYVNVNGQSGYFDRSLDAYGREGEHCRRCGAVMRREKFMNRSSFYCPRCQPRPRR
Bibliography
No article yet recorded