Gene MMAR_1783 
in Mycobacterium marinum M
General annotation
      | Type | CDS | 
| Function | involved in base excision repair (repair of oxidized purines). this enzyme may play a significant role in processes leading to recovery from mutagenesis and/or cell death by alkylating agents [catalytic activity hydrolysis of DNA containing ring-opened N7-methylguanine residues, releasing 2,6-diamino-4-hydroxy-5-(N-methyl)formamidopyrimide]. | 
| Product | formamidopyrimidine-DNA glycosylase Fpg | 
| Comments | - | 
| Functional category | Information pathways | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2175510 | 2176388 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium marinum M|MMAR_1783|fpg
MPELPEVEVVRRGLQDHVVGKTMTAVRVHHPRAVRRHEAGPADLTARLLGARISGTDRRGKYLWLTLDAGAPTTGRDDPDTALVVHLGMSGQMLLGGVPRAEHVRISAVLDDGTVLSFADQRTFGGWQLADLVSVDGSVVPAPVAHLARDPLDPLFDVDSVIKVLRGKHSEIKRQLLDQQVVSGIGNIYADEALWRAKVHGARVAATLTRRQLGAVLDAAADVMREALAKGGTSFDSLYVNVNGQSGYFDRSLDAYGREGEHCRRCGAVMRREKFMNRSSFYCPRCQPRPRR
      
    Bibliography
    No article yet recorded