Gene MMAR_1992
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in regulation of nucleotide excision repair and SOS response. represses a number of genes involved in the response to DNA damage (SOS response), including RecA and LexA. has been shown to bind to the 14 bp palindromic sequence 5'-CGAACNNNNGTTCG-3'. in the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair [catalytic activity: hydrolysis of ala-|-gly bond in repressor LexA]. |
| Product | repressor LexA |
| Comments | - |
| Functional category | Regulatory proteins |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2413842 | 2414576 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_1992|lexA
MSDSSDTTVDGASDGASDGASGADNRAQLVDTALTERQRTILNVIRTSVNDRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVDVRGADDTVTAAPVTDVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGQGTLFLLKVVGESMIEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQIWLMPHNPAFDPIPGNDATVLGKVVTVIRKI
Bibliography
No article yet recorded
