Gene MMAR_2002
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | transcriptional regulatory protein (repressor and activator), iron-binding repressor of siderophore biosynthesis and iron uptake. seems to regulate a variety of genes encoding a variety of proteins E.G. transporters, proteins involved in siderophore synthesis and iron storage, members of the PE/PPE family, enzymes involved in lipid metabolism, transcriptional regulatory proteins, etc. also activator of BfrA gene. |
| Product | iron-dependent repressor and activator IdeR |
| Comments | - |
| Functional category | Regulatory proteins |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2423029 | 2423721 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2002|ideR
MNDLVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMERDGLLRVAGDRHLELTDKGRALAVAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLLDLGVGPESDSYEANLVRLTELPSGSPVAVVVRQLTEHVQGDIDLISRLKDAGVVPNARVTVETSPAGGVTILIPGHENVTLPHAMAHAVKVEKV
Bibliography
No article yet recorded