Gene MMAR_2032
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoidbiosynthesis (at the first step), and in the biosynthetic pathway to thiamine and pyridoxol (at the first step). catalyzes the acyloin condensation reaction between atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D-xylulose-5-phosphate (DXP). |
| Product | 1-deoxy-D-xylulose 5-phosphate synthase Dxs1 |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2449148 | 2451061 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2032|dxs1
MLQQIRGPADLQHLSQAQLRELAQEIREFLVHKVAATGGHLGPNLGVVELTLALHRVFDSPHDPIIFDTGHQAYVHKMLTGRAQDFESLRKKGGLSGYPCRAESEHDWVESSHASAALSYADGLSKAFELSGLRNRHVVAVVGDGALTGGMCWEALNNIAASHRPVVIVVNDNGRSYAPTIGGVADHLAKLRLQPAYEQVLEKGRDVVRAVPLVGEVCYHFMHSVKAGIKDSLSPQLLFTDLGLKYVGPVDGHDERAVEVALRSARGFGGPVIVHVVTRKGMGYGPAEADVAEQMHSTVPIDPATGQATKLAGPGWTTTFADALIEYAGKRRDIVAITAAMPGPTGLTAFGQQFPDRLFDVGIAEQHAMTSAAGLAMGGMHPVVAIYSTFLNRAFDQIMMDVALHQLPVTMVLDRAGITGSDGPSHNGMWDLSMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDIPALERRDGMDVLAVPASGLNHDVLLIAVGALASMALAVAKRLHNQGIGVTVIDPRWVLPVADGIGDLAVAHKLVVTLEDNGVNGGVGSAVSAALRRAEIDVPCRDVGLPQQFFEHASRGELLADLGLTDQDVARRVTGWVAALGACVSEAEIKEHLD
Bibliography
No article yet recorded