Gene MMAR_2223
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | riboflavin synthase is a bifunctional enzyme complex involved in riboflavin synthesis. riboflavin synthase catalyzes the formation of riboflavin from 5-amino-6-(1'-D)- ribityl-amino-2,4(1H,3H)-pyrimidinedione and L-3,4-dihydrohy-2- butanone-4-phosphate via 6,7-dimethyl-8-lumazine. the beta subunit catalyzes the condensation of 5-amino-6-(1'-D)-ribityl- amino-2,4(1H,3H)-pyrimidinedione with L-3,4-dihydrohy-2-butanone- 4-phosphate yielding 6,7-dimethyl-8-lumazine. |
| Product | riboflavin synthase beta chain RibH |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2672806 | 2673288 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2223|ribH
VSGGAGIPDVPAFDASDVRLAIVASTWHTKICDALLAGARNTAADSGIDNPTVVRVLGAIEIPVVAQELTRNHDAVVALGVVIRGETPHFDYVCDAVTQGLTRVSLDSSTPVANGVLTTNSEEQALNRAGLPTSDEDKGAQATAAALTTALTLRELRAEA
Bibliography
No article yet recorded