Gene MMAR_2306
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | unknown. contains Cdd pfam07311, DUF1458, protein of unknown function (DUF1458). this family consists of several hypothetical bacterial proteins as well as one archaeal sequence. members of this family are typically of around 70 residues in length. the function of this family is unknown. |
| Product | conserved hypothetical protein |
| Comments | - |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2773355 | 2773567 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2306|MMAR_2306
MSDHTYRVIEIVGSSADGVDAAIRNGLTRAAQTMRALDWFEVESVRGHLVDGAVGHFQVTMKVGFRLEDS
Bibliography
No article yet recorded