Gene MMAR_2425
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in the respiratory chain (at the terminal step): aerobic respiration. cytochrome D terminal oxidase complex is the component of the aerobic respiratory chain that is supposed predominated when cells are grown at low aeration [catalytic activity: ubiquinol-8 + O(2) = ubiquinone-8 + H(2)O]. |
| Product | integral membrane cytochrome D ubiquinol oxidase (subunit II) CydB |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2926439 | 2927479 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2425|cydB
LGLQELWFAVIAVLFLGFFILEGFDFGVGMLMAPFAHFGTGDPEIHRRTALNTIGPVWDGNEVWLITGGAAMFAAFPGWYATVFSTLYLPLLAILFGMIVRSVAIEWRGKVDDPKWRALADFGIAAGSWLPAILWGVAFAILVRGLPVDADGHVALSIGDVLNAYTLLGGLATAGLFLFYGAVFVALKTAGPIRDDAYRFAVVLSLPVTVLVAGFGVWTQLAYGKQWTWALLGVAVVAQLAAVLLVWRRVSDGWAFLCIAVVVAAVVLLLFGALYPNLVPSTLNERWNVTIYNASSTPYTLKIMTWVTALFAPLTVVYQAWTYWVFRQRISAERIPPSIGLARRPS
Bibliography
No article yet recorded