Gene MMAR_2754
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | Unknown |
| Product | alkyl hydroperoxide reductase D protein AhpD |
| Comments | - |
| Functional category | Virulence, detoxification, adaptation |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3358783 | 3359319 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2754|ahpD
MSIENLKAALPEYAKDLKLNLGSISRTTVLDEEQLWGTLLASAAATRNAQVLAEIGAEAADNLSAQAYQAALGAVSIMGMNNVFYRGRGFLEGQYDDLRAGLRMNIIANPGVDKANFELWSFAVSSVNGCSHCVVAHEHTLREAGVGREAVLEALKAAAIVCGVAQALTAAQTLAAVG
Bibliography
No article yet recorded