Gene MMAR_2761
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in iron storage (may perform analogous functions in iron detoxification and storage as that of animal ferritins); ferritin is an intracellular molecule that stores iron in a soluble, nontoxic, readily available form. the functional molecule, which is composed of 24 chains, is roughly spherical and contains a central cavity in which the polymeric ferric iron core is deposited. |
| Product | bacterioferritin BfrA |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3363475 | 3363954 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2761|bfrA
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAAHTRDESFDEMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVVNRLKPGIIMCREKQDSTSAVLFESIVADEEKHIDYLETQLELMNKLGEELYSAQCVSRPPS
Bibliography
No article yet recorded