Gene MMAR_2920
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | adds the distal cyclopropane ring to alpha-meroacid in mycolic acid biosynthesis. mycolic acids represent a major constituent of the mycobacterial cell wall complex. methyl transfer results in formation of a secondary hydroxy group with an adjacent methyl branch; olefinic mycolic acid methyl transferase. |
| Product | methoxy mycolic acid synthase 2 MmaA2 _1 |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3523957 | 3524820 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_2920|mmaA2_1
MAQRLVPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLEEAQIAKIDLALGKLGLEPGMTLLDIGCGWGATMRRAIEKHDVNVVGLTLSNNQAAHVQKSFDQLDTARTRRVLLKGWEQFDEPVDRIVSIGAFEHFGHDRYDDFFAMAHRVLPRGGVMLLHTITGLTREQISDRGIPISIDMIRFVKFIVTEIFPGGRLPSIDMVQQHAGRAGFTLTRRQSLQPHYARTLALWAQALYAYRDEAIEIQSEEVYERYLKYLTGCADAFRRGHIDVNQFTLQN
Bibliography
No article yet recorded