Gene MMAR_4468
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | catalyzes the formation of PRPP from ATP and ribose 5-phosphate. PRPP is then used in various biosynthetic pathways, as for example in the formation of purines, pyrimidines, histidine and tryptophan. [catalytic activity: ATP + D-ribose 5-phosphate = AMP + 5-phospho-alpha-D-ribose 1-diphosphate] |
| Product | ribose-phosphate pyrophosphokinase PrsA |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5490018 | 5490998 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4468|prsA
LSHDWTDNRKNLMLFSGRAHPELAEQVAKELDVHVTAQTAREFANGEIFVRFQESVRGCDAFVLQSCPAPVNTWLMEQLIMIDALKRGSAKRITAVMPFYPYARQDKKHRGREPISARLVADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIRDNYSDNNMVVVSPDSGRVRIAEKWADALGGVPLAFIHKTRDPRVPNQVVSNRVVGDVAGRTCVLIDDMIDTGGTIAGAVQLLRNDGAGDVIIAATHGVLSDPAAERLAACGAREVIVTNTLPITEAKRFPQLTVLSIAPLLASTIRAVFENGSVTGLFDGDA
Bibliography
No article yet recorded