Gene MMAR_4468 
in Mycobacterium marinum M
General annotation
      | Type | CDS | 
| Function | catalyzes the formation of PRPP from ATP and ribose 5-phosphate. PRPP is then used in various biosynthetic pathways, as for example in the formation of purines, pyrimidines, histidine and tryptophan. [catalytic activity: ATP + D-ribose 5-phosphate = AMP + 5-phospho-alpha-D-ribose 1-diphosphate] | 
| Product | ribose-phosphate pyrophosphokinase PrsA | 
| Comments | - | 
| Functional category | Intermediary metabolism and respiration | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 5490018 | 5490998 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium marinum M|MMAR_4468|prsA
LSHDWTDNRKNLMLFSGRAHPELAEQVAKELDVHVTAQTAREFANGEIFVRFQESVRGCDAFVLQSCPAPVNTWLMEQLIMIDALKRGSAKRITAVMPFYPYARQDKKHRGREPISARLVADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIRDNYSDNNMVVVSPDSGRVRIAEKWADALGGVPLAFIHKTRDPRVPNQVVSNRVVGDVAGRTCVLIDDMIDTGGTIAGAVQLLRNDGAGDVIIAATHGVLSDPAAERLAACGAREVIVTNTLPITEAKRFPQLTVLSIAPLLASTIRAVFENGSVTGLFDGDA
      
    Bibliography
    No article yet recorded