Gene MMAR_4525
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | Unknown |
| Product | large-conductance ion mechanosensitive channel MscL |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5553543 | 5553998 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_4525|mscL
MLKGFKEFLSRGNIVDLAVAVVIGTAFTALVTRFTDSIITPLINRVGVNEQSDLGILKIGIGRGQSIDLNVLLSATINFILVAGVVYFLVVVPYNTLRKKGEVEQADDAQIVLLTEIRDLLAQTNSNSSGRHEAPGTAGTPPPNYGPRADT
Bibliography
No article yet recorded