Gene MMAR_5111
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in dihydrofolate biosynthesis (at the second step). catalyzes the formation of the immediate precursor of folic acid. it is implicated in resistance to sulfonamide [catalytic activity: 2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine diphosphate + 4-aminobenzoate = pyrophosphate + dihydropteroate]. |
| Product | dihydropteroate synthase 1 FolP1 |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6189644 | 6190486 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5111|folP1
VSSRPVQVMGVLNVTNDSFSDGGRYCDEAKAIEHGLALAAEGADIIDVGGESTRPGAARVDPAVEASRVLPVIKELAARGIKVSIDTTRAAVACEALHNGAQIVNDVSGGRADPAMAPLVAEAGVPWVLMHWRPVSDDNPHQVPNYRDVVAEVRAELLTAVDDAIAAGVGPSNLMIDPGLGFAKAGQHNWTLLHALPELVATGIPVLVGASRKRFLGSLLAGPDGAVRPPDGRETATAVISALAALHGAWGVRVHDVRASVDALKVVDAWQRAERTGHDG
Bibliography
No article yet recorded