Gene MMAR_5131
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | unknown, the domain detected in this CDS is found in a diverse family of glycosyl transferases that transfer the sugar from UDP-glucose, UDP-N-acetyl-galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids. |
| Product | glycosyl transferase |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6210201 | 6210902 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5131|MMAR_5131
MDIDTHHPDVWIVVPAFNEATVIGEVIAQLRSTFGHVVCVDDGSTDGTGDIALRAGAHVVAHPINLGQGAAIQTGVEYARKQPGAQIFATFDADGQHRVKDLAAMVHRLSVGDVDVVIGTRFGRPVGSRPPLLKRIVLQTAARLSPRGRRLGLTDTNNGLRVFNKTVADGLNITMSGMSHATEFVMLIAENHWRVAEEPVEVLYTDYSKSKGQPLLNGVNIIFDGFLRGRIRR
Bibliography
No article yet recorded