Gene MMAR_5368
in Mycobacterium marinum M
General annotation
| Type | CDS |
| Function | involved in cell wall mycoloylation. proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. |
| Product | secreted antigen 85-A FbpA |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 6499893 | 6500906 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium marinum M|MMAR_5368|fbpA
MKLVDRFRGAVTGTPRRLMVGAVGAALLSGLVGFVGGSATASAFSRPGLPVEYLQVPSAAMGRNIKVQFQSGGANSPALYLLDGMRAQDDFSGWDINTPAFEWYYQSGISVAMPVGGQSSFYSDWYNPACGKAGCTTYKWETFLTSELPQYLSANKGVKPTGSGVVGLSMAGSSALILAAYHPDQFVYSGSLSALLDPSQGMGPSLIGLAMGDAGGYKASDMWGPKDDPAWARNDPMLQVGKLVANNTRIWVYCGNGKPSDLGGDNLPAKFLEGFVRTSNMKFQAAYNAAGGHNAVWNFDDNGTHSWEYWGAQLNAMKPDLQHTLGATPNTGDTQGA
Bibliography
No article yet recorded