Gene MSMEG_2645
in Mycobacterium smegmatis MC2-155
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | - |
| Functional category | Unknown |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2725764 | 2726348 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium smegmatis MC2-155|MSMEG_2645|MSMEG_2645
MAARVRLLSALCALVAAVILVWQTDPVAGTGSAAPRLDATDLPMTNVSTTIKWPVIETTDPKPFDPCNDIPIDVIERIGLAWTPPMPEDGLRCHYDAGNYQMAVEAFVWRTYEQTIPADALELDIDGHRAAQYWVMKPTDWNDRWWTTCMIAFDTSYGVIQQSLFYSPIHSPDKPDCLQTNLQRAHELAPYYKF
Bibliography
No article yet recorded