Gene MSMEG_3218
in Mycobacterium smegmatis MC2-155
General annotation
| Type | CDS |
| Function | Unknown |
| Product | trp region conserved hypothetical membrane protein |
| Comments | identified by match to protein family HMM TIGR02234 |
| Functional category | Unknown |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3296355 | 3296969 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium smegmatis MC2-155|MSMEG_3218|MSMEG_3218
MTRAAQALLVVAALGLWGASRFNWVEVRSFDGLGQPKTTALTGASWSTALIPLALLALAAAVAALAVRGWMLRLLAILVAAASAGMGYLAISLWAVRDVAVRAADLALVPVAQLTGTHRYYTGAVITLAAAVCTLVGAVLLMRSANGSQRAVAARYAAPAARRTAAQHDVSSESMSERMIWDALDEGHDPTGDQDDTDRRGGDR
Bibliography
No article yet recorded