Gene MSMEG_4273
in Mycobacterium smegmatis MC2-155
General annotation
| Type | CDS |
| Function | Unknown |
| Product | integral membrane protein |
| Comments | - |
| Functional category | Unknown |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4356838 | 4357524 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium smegmatis MC2-155|MSMEG_4273|MSMEG_4273
MKLLGRKNNDDDKNVASDAADSAVDEQNGPAAEDRPRTTPPKGRPTPKRSEAAKRRGPVAPAPLTAAEARARRKEMRKTLTKEERKAEKITRRAEMAERRERMMAGEEAYLLPRDRGPVRRYVRDIVDSRRNILGLFMPAALAMIFFMLALPNVQAQQVLSYAMLALVAVMVLDGFYLGRKVNRMVDAKFPDNTEGGWKLGFYASSRASQLRRMRAPRPMVERGAKIA
Bibliography
No article yet recorded