Gene MSMEG_4935
in Mycobacterium smegmatis MC2-155
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ATP synthase F1, epsilon subunit |
| Comments | identified by match to protein family HMM PF02823; match to protein family HMM TIGR01216 |
| Functional category | Unknown |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 5032225 | 5032590 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium smegmatis MC2-155|MSMEG_4935|atpC
MADLNVEIVAVERELWSGPATFVFTRTTAGEIGILPRHIPLVAQLVDDAMVRVEREGEDDLRIAVDGGFLSVTEETVRILVENAQFESEIDADAAKEDAASDDERTAAWGRARLRALGQID
Bibliography
No article yet recorded