Gene RJtmp_000558
in Mycobacterium orygis 51145
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hypothetical protein |
| Comments | - |
| Functional category |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 624180 | 624341 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium orygis 51145|RJtmp_000558|RJtmp_000558
MLYLLLVLILATLIYLGWRAARAQMNRPKTRVIGPDDDPEFLRRLGHGDNNRS
Bibliography
- Rufai SB et al. [2021]. Complete Genome Sequence of Mycobacterium orygis Strain 51145. sequence