Gene RJtmp_002685 
in Mycobacterium orygis 51145
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | crossover junction endodeoxyribonuclease RuvC | 
| Comments | - | 
| Functional category | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2883534 | 2884100 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium orygis 51145|RJtmp_002685|ruvC
MRVMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMAEATSRAEARAAQQRHAYLAKLKAAR
      
    Bibliography
    - Rufai SB et al. [2021]. Complete Genome Sequence of Mycobacterium orygis Strain 51145. sequence