Gene Rv0075
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Probable aminotransferase |
| Comments | Rv0075, (MTV030.19), len: 390 aa. Probable aminotransferase, similar to many class-II pyridoxal-phosphate-dependent aminotransferases (MALY/PATB subfamily). Also similar to other proteins from Mycobacterium tuberculosis e.g. Rv2294, Rv0858c, etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 83996 | 85168 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0075|Rv0075
MQDSIFNLLTEEQLRGRNTLKWNYFGPDVVPLWLAEMDFPTAPAVLDGVRACVDNEEFGYPPLGEDSLPRATADWCRQRYGWCPRPDWVRVVPDVLKGMEVVVEFLTRPESPVALPVPAYMPFFDVLHVTGRQRVEVPMVQQDSGRYLLDLDALQAAFVRGAGSVIICNPNNPLGTAFTEAELRAIVDIAARHGARVIADEIWAPVVYGSRHVAAASVSEAAAEVVVTLVSASKGWNLPGLMCAQVILSNRRDAHDWDRINMLHRMGASTVGIRANIAAYHHGESWLDELLPYLRANRDHLARALPELAPGVEVNAPDGTYLSWVDFRALALPSEPAEYLLSKAKVALSPGIPFGAAVGSGFARLNFATTRAILDRAIEAIAAALRDIID
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant