Gene Rv0085
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in hydrogen metabolism. |
| Product | Possible hydrogenase HycP |
| Comments | Rv0085, (MTCY251.03), len: 220 aa. Possible hycP, hydrogenase, integral membrane protein. Belongs to NADH-ubiquinone/plastoquinone oxidoreductase chain 4L superfamily. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 93289 | 93951 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0085|hycP
MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALAAIPLLRGIRDNDRALIAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLLITAGLTLTAFAITQPVVNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLDNGIAATAFLLTAGVPLIVELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
